powered by:
Protein Alignment CG13138 and CITED4
DIOPT Version :9
Sequence 1: | NP_609372.1 |
Gene: | CG13138 / 34381 |
FlyBaseID: | FBgn0032211 |
Length: | 549 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_597724.1 |
Gene: | CITED4 / 163732 |
HGNCID: | 18696 |
Length: | 184 |
Species: | Homo sapiens |
Alignment Length: | 95 |
Identity: | 25/95 - (26%) |
Similarity: | 26/95 - (27%) |
Gaps: | 46/95 - (48%) |
- Green bases have known domain annotations that are detailed below.
Fly 461 PGRD------GVSLKLVGPPTPFNITGKDLETANSAPDFVNSSNVDLSPQESANAYR--GMPFSI 517
||.| |..| |||.| .|..|.||. |.|.|.
Human 38 PGLDSGLRPRGAPL---GPPPP--------------------------RQPGALAYGAFGPPSSF 73
Fly 518 -PFQFV--------QLQPMAFQSPIHVELP 538
||..| .|||:|...|.....|
Human 74 QPFPAVPPPAAGIAHLQPVATPYPGRAAAP 103
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CMI8 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.