DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13138 and Cited4

DIOPT Version :9

Sequence 1:NP_609372.1 Gene:CG13138 / 34381 FlyBaseID:FBgn0032211 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_446151.1 Gene:Cited4 / 114491 RGDID:620113 Length:179 Species:Rattus norvegicus


Alignment Length:110 Identity:26/110 - (23%)
Similarity:30/110 - (27%) Gaps:48/110 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 YVPKTSIESTSPGRD------GVSLKLVGPPTPFNITGKDLETANSAPDFVNSSNVDLSPQESAN 508
            :.|:|......||.|      |..|   |||                            |.....
  Rat    18 HAPRTLQPYPGPGLDSGLRPRGAPL---GPP----------------------------PPSGTL 51

  Fly   509 AYR--GMPFSI-PFQFVQ--------LQPMAFQSPIHVELPIQSA 542
            ||.  |.|.|. ||...|        ||..|..||..:..|..:|
  Rat    52 AYGSFGSPVSFQPFPVSQPPGAGNAHLQSAATPSPGRMPAPPSAA 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13138NP_609372.1 IMCp 188..279 CDD:289112
Cited4NP_446151.1 CITED 1..179 CDD:282356 26/110 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..122 24/105 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.