DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13138 and AgaP_AGAP013465

DIOPT Version :9

Sequence 1:NP_609372.1 Gene:CG13138 / 34381 FlyBaseID:FBgn0032211 Length:549 Species:Drosophila melanogaster
Sequence 2:XP_003436403.1 Gene:AgaP_AGAP013465 / 11175995 VectorBaseID:AGAP013465 Length:178 Species:Anopheles gambiae


Alignment Length:127 Identity:57/127 - (44%)
Similarity:74/127 - (58%) Gaps:10/127 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 HHHHNHIKE--LIKTVPQPYPVEKVVHVPIEKIVEKIVHVPKLVNVTVEKIVHVPIEKIVEKVIH 237
            |....|:|.  ::|.||.|||||...|||:|..|...|.|.|.|.|.|||  .||:  :|||.:|
Mosquito    54 HKEEEHVKHVTIVKKVPVPYPVEVTKHVPVEVKVPYPVEVEKKVPVYVEK--KVPV--VVEKKVH 114

  Fly   238 IPKPVQVP--KPYVVEKIIEKIVHVPKPYPVLRTVPYPVEIKVPVHLEKKVPVPYKVEVERK 297
            :.:||..|  .|..|..|.::.|.|||||||....|.||.||.||::||.|||  .:.:::|
Mosquito   115 VDRPVPYPVKVPVKVPVIHKEYVEVPKPYPVHVEKPVPVYIKKPVYIEKTVPV--SIHIKKK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13138NP_609372.1 IMCp 188..279 CDD:289112 45/92 (49%)
AgaP_AGAP013465XP_003436403.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.