DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYLD and RPS1B

DIOPT Version :9

Sequence 1:NP_609371.2 Gene:CYLD / 34380 FlyBaseID:FBgn0032210 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_013648.1 Gene:RPS1B / 854939 SGDID:S000004528 Length:255 Species:Saccharomyces cerevisiae


Alignment Length:288 Identity:54/288 - (18%)
Similarity:97/288 - (33%) Gaps:106/288 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 WIGI-PPGPQKNVLVGIEVEDES-NLKNVVASDGRHNGVRLFTCHDGRAIFVPANRCTADRRFAD 226
            |..| .|...:|..||..:.::| .|||  |||..          .||.:.|    |.||.:.::
Yeast    29 WFDIKAPSTFENRNVGKTLVNKSTGLKN--ASDAL----------KGRVVEV----CLADLQGSE 77

  Fly   227 ----------VDNSISANRVSSNHAKKFGVADCPAIYGSIPPLQIHNSDELASICGKFKGIQGHH 281
                      ||.....|.:::.|...|                  .:|:|.|:..|::      
Yeast    78 DHSFRKVKLRVDEVQGKNLLTNFHGMDF------------------TTDKLRSMVRKWQ------ 118

  Fly   282 NSCYLDATLFSMFTFTSVFDSILYRRPGPQDIRNYSEVQKVLRDEIVNPLRKNVFVRSDRVMKLR 346
                   ||..........|..:.|      |...:..:|.     .|.::::.:.:|..:..:|
Yeast   119 -------TLIEANVTVKTSDDYVLR------IFAIAFTRKQ-----ANQVKRHSYAQSSHIRAIR 165

  Fly   347 ELLDQLSSVSGLTCEEKDPEEFLNSLLSQIMRVEPFLKLSSGQDSYFYQLFVEKDEKLTLPSVQQ 411
            :::.::     ||      .|..||.|:|:..                :|..|...|....:.:.
Yeast   166 KVISEI-----LT------REVQNSTLAQLTS----------------KLIPEVINKEIENATKD 203

  Fly   412 LFE-QSFHSSDIKLKEVPSCFIIQMPRF 438
            :|. |:.|...:||        ::.|:|
Yeast   204 IFPLQNIHVRKVKL--------LKQPKF 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYLDNP_609371.2 CAP_GLY 143..219 CDD:214997 16/56 (29%)
Peptidase_C19N 276..631 CDD:239135 26/164 (16%)
RPS1BNP_013648.1 Ribosomal_S3Ae 22..221 CDD:395802 52/284 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11830
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.