DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYLD and AT4G34670

DIOPT Version :9

Sequence 1:NP_609371.2 Gene:CYLD / 34380 FlyBaseID:FBgn0032210 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_195193.1 Gene:AT4G34670 / 829619 AraportID:AT4G34670 Length:262 Species:Arabidopsis thaliana


Alignment Length:171 Identity:27/171 - (15%)
Similarity:63/171 - (36%) Gaps:43/171 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 SDELASICGKFKG-IQGHHNSCYLDATLFSMF--TFTSVFDSILYRRPGPQDIRNYSEVQKVLRD 325
            :|:|.|:..|::. |:.|.:....|.....||  .||.       ||                  
plant   107 TDKLRSLVKKWQTLIEAHVDVKTTDGYTLRMFCIAFTK-------RR------------------ 146

  Fly   326 EIVNPLRKNVFVRSDRVMKLRELLDQLSSVSGLTCEEKD------PEEFLNSLLSQIMRVEPFLK 384
              .|.:::..:.:|.::.::|..:.::......:|:.|:      ||.....:......:.|.  
plant   147 --ANQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGREIEKATQGIYPL-- 207

  Fly   385 LSSGQDSYFYQLFVEKDEKLTLPSVQQLFEQSFHSSDIKLK 425
                |:.:..::.:.|..|..|..:.:: ...:.:.|:.:|
plant   208 ----QNVFIRKVKILKAPKFDLGKLMEV-HGDYTAEDVGVK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYLDNP_609371.2 CAP_GLY 143..219 CDD:214997
Peptidase_C19N 276..631 CDD:239135 23/159 (14%)
AT4G34670NP_195193.1 Ribosomal_S3Ae 20..221 CDD:395802 23/146 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11830
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.