DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYLD and AT4G34670

DIOPT Version :10

Sequence 1:NP_609371.2 Gene:CYLD / 34380 FlyBaseID:FBgn0032210 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_195193.1 Gene:AT4G34670 / 829619 AraportID:AT4G34670 Length:262 Species:Arabidopsis thaliana


Alignment Length:171 Identity:27/171 - (15%)
Similarity:63/171 - (36%) Gaps:43/171 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 SDELASICGKFKG-IQGHHNSCYLDATLFSMF--TFTSVFDSILYRRPGPQDIRNYSEVQKVLRD 325
            :|:|.|:..|::. |:.|.:....|.....||  .||.       ||                  
plant   107 TDKLRSLVKKWQTLIEAHVDVKTTDGYTLRMFCIAFTK-------RR------------------ 146

  Fly   326 EIVNPLRKNVFVRSDRVMKLRELLDQLSSVSGLTCEEKD------PEEFLNSLLSQIMRVEPFLK 384
              .|.:::..:.:|.::.::|..:.::......:|:.|:      ||.....:......:.|.  
plant   147 --ANQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGREIEKATQGIYPL-- 207

  Fly   385 LSSGQDSYFYQLFVEKDEKLTLPSVQQLFEQSFHSSDIKLK 425
                |:.:..::.:.|..|..|..:.:: ...:.:.|:.:|
plant   208 ----QNVFIRKVKILKAPKFDLGKLMEV-HGDYTAEDVGVK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYLDNP_609371.2 CAP_GLY 143..219 CDD:214997
Peptidase_C19N 276..631 CDD:239135 23/159 (14%)
AT4G34670NP_195193.1 Ribosomal_S3Ae 20..221 CDD:425987 23/146 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.