DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYLD and AT3G04840

DIOPT Version :10

Sequence 1:NP_609371.2 Gene:CYLD / 34380 FlyBaseID:FBgn0032210 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_187135.1 Gene:AT3G04840 / 819644 AraportID:AT3G04840 Length:262 Species:Arabidopsis thaliana


Alignment Length:175 Identity:40/175 - (22%)
Similarity:71/175 - (40%) Gaps:27/175 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 GKFKGIQGHHNSCYLDATLFSMFTFTSVFDSILYRRPGPQDIRNYSEVQKV-------LRDEIVN 329
            ||.|.:.......:.|....|:||..:|..:::.|..|.: |.:.....:|       |:.:..|
plant    16 GKKKAVDPFSKKDWYDVKAPSIFTHRNVGKTLVSRTQGTK-IASEGLKHRVFEVSLADLQGDEDN 79

  Fly   330 PLRKNVFVRSDRVMKLRELLDQLSSVSGLTCEEKDPEEFLNSLLSQIMR-VEPFLKLSSGQDSYF 393
            ..|| :.:|::.|.. |.:|.|...:...|       :.|.||:.:... :|..:.:.: .|||.
plant    80 AYRK-IRLRAEDVQG-RNVLCQFWGMDFTT-------DKLRSLVKKWQTLIEAHVDVKT-TDSYT 134

  Fly   394 YQLFVEKDEKLTLPSVQQ-LFEQSFH-------SSDIKLKEVPSC 430
            .:||.....|.....|:: .:.||..       ..||.::|..||
plant   135 LRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRDIMVREASSC 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYLDNP_609371.2 CAP_GLY 143..219 CDD:214997
Peptidase_C19N 276..631 CDD:239135 37/171 (22%)
AT3G04840NP_187135.1 Ribosomal_S3Ae 20..221 CDD:425987 37/171 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.