DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYLD and rps102

DIOPT Version :9

Sequence 1:NP_609371.2 Gene:CYLD / 34380 FlyBaseID:FBgn0032210 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_593116.1 Gene:rps102 / 2541737 PomBaseID:SPAC22H12.04c Length:252 Species:Schizosaccharomyces pombe


Alignment Length:101 Identity:21/101 - (20%)
Similarity:46/101 - (45%) Gaps:7/101 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 NPLRKNVFVRSDRVMKLRELLDQLSSVSGLTCEEKDPEEFLNSLLSQIMRVEPFLKLSSGQDSYF 393
            |.::|..:.:|.::..:|:.:.|:......:|..:   |.:..|:.:::..|  ::.::|.....
pombe   148 NQVKKTTYAQSSQIRAIRQKMFQVIQNQTSSCSMR---ELVQKLIPEVIGRE--IERATGSIFPL 207

  Fly   394 YQLFVEKDEKLTLP--SVQQLFEQSFHSSDIKLKEV 427
            ..:.|.|.:.|..|  ..|:|.|....|.|:..|.|
pombe   208 QNVLVRKVKILKAPKHDAQKLLELHGESQDVGTKVV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYLDNP_609371.2 CAP_GLY 143..219 CDD:214997
Peptidase_C19N 276..631 CDD:239135 21/101 (21%)
rps102NP_593116.1 RPS3A 10..240 CDD:224802 19/96 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11830
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.