DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and HAND1

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_004812.1 Gene:HAND1 / 9421 HGNCID:4807 Length:215 Species:Homo sapiens


Alignment Length:124 Identity:64/124 - (51%)
Similarity:81/124 - (65%) Gaps:10/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLDGDL- 118
            |:.:::.:..|||||||:|||:||:.|||.|||||.||||||||||:||..||.||::||..|. 
Human    91 RLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQ 155

  Fly   119 --DPKGGFRAELKPVSRKICSEKKHCLKSE------IQNVPLSTKGRTGWPQDVWASEL 169
              ||: .|:||||.......|::|..|:..      :..|....||||||||.|||.||
Human   156 SGDPE-AFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALEL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 34/50 (68%)
HAND1NP_004812.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 8/17 (47%)
bHLH_TS_HAND1 94..153 CDD:381522 38/58 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..198 6/31 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149590
Domainoid 1 1.000 80 1.000 Domainoid score I8620
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3545
Inparanoid 1 1.050 124 1.000 Inparanoid score I4727
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449816at2759
OrthoFinder 1 1.000 - - FOG0005250
OrthoInspector 1 1.000 - - otm41218
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3772
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.