powered by:
Protein Alignment Hand and TWIST1
DIOPT Version :9
Sequence 1: | NP_609370.2 |
Gene: | Hand / 34379 |
FlyBaseID: | FBgn0032209 |
Length: | 174 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_000465.1 |
Gene: | TWIST1 / 7291 |
HGNCID: | 12428 |
Length: | 202 |
Species: | Homo sapiens |
Alignment Length: | 76 |
Identity: | 40/76 - (52%) |
Similarity: | 52/76 - (68%) |
Gaps: | 2/76 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 GYVPTSNTRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLV 111
|..|.|...:..:|..||.:||:||||:|.||:.||:.||.:|:| |||||:|||||..||::|.
Human 97 GGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSD-KLSKIQTLKLAARYIDFLY 160
Fly 112 NVLDGD-LDPK 121
.||..| ||.|
Human 161 QVLQSDELDSK 171
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165149614 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5507 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.870 |
|
Return to query results.
Submit another query.