DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Atoh8

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_722473.1 Gene:Atoh8 / 71093 MGIID:1918343 Length:322 Species:Mus musculus


Alignment Length:139 Identity:38/139 - (27%)
Similarity:60/139 - (43%) Gaps:27/139 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SESQVQQQIYNT---------SHLGYVPTSNTRIVKKRNT----ANKKERRRTQSINNAFSYLRE 83
            |.|.:...|||.         ...|....::|.|...:.|    ||.:||.|..:|:.||..||:
Mouse   192 SYSSISHVIYNNHPDSSASPRKRPGEATAASTEIKALQQTRRLLANARERTRVHTISAAFEALRK 256

  Fly    84 KIPNVPTDTKLSKIKTLKLAILYINYLVNVLDGDLDPKGGFRAELKPVSRKICSEKKHCLKSEIQ 148
            ::|......||||:..|::|..||..|..:.|.|      :.|:...:|...|.::  |.::   
Mouse   257 QVPCYSYGQKLSKLAILRIACNYILSLARLADLD------YSADHSNLSFSECVQR--CTRT--- 310

  Fly   149 NVPLSTKGR 157
               |..:||
Mouse   311 ---LQAEGR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 21/58 (36%)
Atoh8NP_722473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..96
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..144
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..221 6/28 (21%)
bHLH_TS_ATOH8 225..292 CDD:381427 24/72 (33%)
Basic motif, degenerate. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 231..244 5/12 (42%)
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 245..283 14/37 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.