DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and TCF15

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_004600.3 Gene:TCF15 / 6939 HGNCID:11627 Length:199 Species:Homo sapiens


Alignment Length:106 Identity:44/106 - (41%)
Similarity:59/106 - (55%) Gaps:18/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVL---DGD 117
            :|::|..||.:||.||||:|.||:.||..||..|.|.|||||:|::||..||.:|.|||   |..
Human    70 VVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETVRLASSYIAHLANVLLLGDSA 134

  Fly   118 LDPKGGFRAE-----LKPVS-------RKICSEKKHCLKSE 146
            .|.:..|||.     ..|.:       |.||:   .||.::
Human   135 DDGQPCFRAAGSAKGAVPAAADGGRQPRSICT---FCLSNQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 28/50 (56%)
TCF15NP_004600.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..67
bHLH_TS_TCF15_paraxis 66..131 CDD:381476 33/60 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149630
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.