| Sequence 1: | NP_609370.2 | Gene: | Hand / 34379 | FlyBaseID: | FBgn0032209 | Length: | 174 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_005412.1 | Gene: | TAL2 / 6887 | HGNCID: | 11557 | Length: | 108 | Species: | Homo sapiens |
| Alignment Length: | 51 | Identity: | 29/51 - (56%) |
|---|---|---|---|
| Similarity: | 39/51 - (76%) | Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 64 NKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVL 114 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Hand | NP_609370.2 | bHLH_TS_HAND | 59..114 | CDD:381472 | 27/49 (55%) |
| TAL2 | NP_005412.1 | bHLH_TS_TAL2 | 2..62 | CDD:381550 | 29/51 (57%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 89..108 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||