DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Tcf24

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_008761741.2 Gene:Tcf24 / 680678 RGDID:1589398 Length:170 Species:Rattus norvegicus


Alignment Length:115 Identity:39/115 - (33%)
Similarity:54/115 - (46%) Gaps:20/115 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLDGDLDPK-----GGFR 125
            :||.|.|::.:||..|:..:|:||.||||||:..|.||..||.:|...|..|.|..     |..|
  Rat    60 RERSRVQTLRHAFLELQRTLPSVPPDTKLSKLDVLLLATTYIAHLTRSLQDDTDAPGDPSLGALR 124

  Fly   126 AE--LKPVSRKICSEKKHCLKSEI------QNVPLSTKGRTGWPQDVWAS 167
            .:  |.||       ||..::|.:      |.:..|..|..|...|..|:
  Rat   125 GDGYLHPV-------KKWPMRSRLYIGATGQFLKHSVPGEKGSHNDAPAA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 21/43 (49%)
Tcf24XP_008761741.2 bHLH_TS_TCF24 53..108 CDD:381553 22/47 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.