DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Hand2

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_073187.1 Gene:Hand2 / 64637 RGDID:621207 Length:217 Species:Rattus norvegicus


Alignment Length:139 Identity:76/139 - (54%)
Similarity:88/139 - (63%) Gaps:14/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SHLGYVP-------TSNTRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLK 101
            ||.|.||       ....|.||:|.|||:||||||||||:||:.|||.|||||.||||||||||:
  Rat    78 SHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLR 142

  Fly   102 LAILYINYLVNVLDGDLDPKG---GFRAELKPVSRKICSEKK---HCLKSEIQNVPLSTKGRTGW 160
            ||..||.||:::|..| |..|   .|:||:|....|....||   ..|||.:.:....|||||||
  Rat   143 LATSYIAYLMDLLAKD-DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGW 206

  Fly   161 PQDVWASEL 169
            ||.|||.||
  Rat   207 PQHVWALEL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 40/54 (74%)
Hand2NP_073187.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..116 20/37 (54%)
bHLH_TS_HAND2 100..161 CDD:381477 43/61 (70%)

Return to query results.
Submit another query.