DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Hand and Twist2

DIOPT Version :9

Sequence 1:	NP_609370.2	Gene:	Hand / 34379	FlyBaseID:	FBgn0032209	Length:	174	Species:	Drosophila melanogaster
Sequence 2:	NP_067723.1	Gene:	Twist2 / 59327	RGDID:	621286	Length:	160	Species:	Rattus norvegicus

Alignment Length:	64	Identity:	36/64 - (56%)
Similarity:	48/64 - (75%)	Gaps:	2/64 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly    59 KRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLDGD-LDPK 121
            :|..||.:||:||||:|.||:.||:.||.:|:| |||||:|||||..||::|..||..| :|.|
  Rat    67 QRILANVRERQRTQSLNEAFAALRKIIPTLPSD-KLSKIQTLKLAARYIDFLYQVLQSDEMDNK 129

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Hand	NP_609370.2	HLH	59..110	CDD:278439	30/50 (60%)
Twist2	NP_067723.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..63
Twist2	NP_067723.1	bHLH_TS_TWIST2	51..132	CDD:381543	36/64 (56%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166343492
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.840