DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Bhlhe22

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_067535.3 Gene:Bhlhe22 / 59058 MGIID:1930001 Length:355 Species:Mus musculus


Alignment Length:50 Identity:24/50 - (48%)
Similarity:29/50 - (57%) Gaps:2/50 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RNTANKKERRRTQSINNAFSYLREKIP--NVPTDTKLSKIKTLKLAILYI 107
            |...|.:||||...:|:|...||..||  :.|:..|||||.||.||..||
Mouse   218 RLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 23/49 (47%)
Bhlhe22NP_067535.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..215
bHLH_TS_bHLHe22_bHLHb5 217..286 CDD:381524 23/49 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.