| Sequence 1: | NP_609370.2 | Gene: | Hand / 34379 | FlyBaseID: | FBgn0032209 | Length: | 174 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_067535.3 | Gene: | Bhlhe22 / 59058 | MGIID: | 1930001 | Length: | 355 | Species: | Mus musculus |
| Alignment Length: | 50 | Identity: | 24/50 - (48%) |
|---|---|---|---|
| Similarity: | 29/50 - (57%) | Gaps: | 2/50 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 60 RNTANKKERRRTQSINNAFSYLREKIP--NVPTDTKLSKIKTLKLAILYI 107 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Hand | NP_609370.2 | bHLH_TS_HAND | 59..114 | CDD:381472 | 23/49 (47%) |
| Bhlhe22 | NP_067535.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 34..90 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 128..215 | ||||
| bHLH_TS_bHLHe22_bHLHb5 | 217..286 | CDD:381524 | 23/49 (47%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||