DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and hand2

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_571701.3 Gene:hand2 / 58150 ZFINID:ZDB-GENE-000511-1 Length:205 Species:Danio rerio


Alignment Length:137 Identity:76/137 - (55%)
Similarity:88/137 - (64%) Gaps:12/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SHLGYVPTSNT-----RIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLA 103
            ||.|.||.:..     |.||:|.|||:||||||||||:||:.|||.|||||.||||||||||:||
Zfish    68 SHYGGVPGAGAVGMGPRTVKRRPTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLA 132

  Fly   104 ILYINYLVNVLDGDLDPKG---GFRAELKPVSRKICSEKKH---CLKSEIQNVPLSTKGRTGWPQ 162
            ..||.||:::||.| :..|   .|:||.|....|....||.   .|||...:....|||||||||
Zfish   133 TSYIAYLMDILDKD-EQNGETEAFKAEFKKTDAKEERRKKEMNDVLKSSGSSNDKKTKGRTGWPQ 196

  Fly   163 DVWASEL 169
            .|||.||
Zfish   197 HVWALEL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 38/50 (76%)
hand2NP_571701.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..103 14/26 (54%)
HLH 88..139 CDD:278439 38/50 (76%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..194 13/35 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583736
Domainoid 1 1.000 79 1.000 Domainoid score I8681
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4702
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449816at2759
OrthoFinder 1 1.000 - - FOG0005250
OrthoInspector 1 1.000 - - oto39144
orthoMCL 1 0.900 - - OOG6_108293
Panther 1 1.100 - - O PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 1 1.000 - - X3772
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.