DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and hand1

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001016743.1 Gene:hand1 / 549497 XenbaseID:XB-GENE-480122 Length:194 Species:Xenopus tropicalis


Alignment Length:142 Identity:68/142 - (47%)
Similarity:82/142 - (57%) Gaps:30/142 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GYVPTSNTRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLV 111
            |.:.|...::.:::....|||||||:|||:||:.|||.|||||.||||||||||:||..||.||:
 Frog    66 GRMETLGGKLGRRKGAPPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIGYLM 130

  Fly   112 NVLDGDLDPKG--GFRAELKPVSRK---------------ICSEKKHCLKSEIQNVPLSTKGRTG 159
            :||..|.:|.|  ||:||||.|..|               ...|||             .|||||
 Frog   131 DVLAKDSEPGGTEGFKAELKKVDGKRRREPQPTEGYWGAAPTGEKK-------------LKGRTG 182

  Fly   160 WPQDVWASELIP 171
            |||.|||.||.|
 Frog   183 WPQQVWALELNP 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 34/50 (68%)
hand1NP_001016743.1 HLH 86..135 CDD:197674 36/48 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8501
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3545
Inparanoid 1 1.050 125 1.000 Inparanoid score I4558
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449816at2759
OrthoFinder 1 1.000 - - FOG0005250
OrthoInspector 1 1.000 - - otm48429
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3772
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.