DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and mespb

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001016653.1 Gene:mespb / 549407 XenbaseID:XB-GENE-970939 Length:292 Species:Xenopus tropicalis


Alignment Length:132 Identity:36/132 - (27%)
Similarity:59/132 - (44%) Gaps:31/132 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NTSHLGYVPTSNTRIVKKRNTANKKERRRTQSINNAFSYLREKIPN--VPTDTKLSKIKTLKLAI 104
            ||..|.|         .:|.:|:::|:.|.::::.|...||..:|.  .|.|..|:||:||:|.|
 Frog    89 NTGKLPY---------SQRQSASEREKLRMRNLSKALQNLRRYLPPSVAPLDKTLTKIETLQLTI 144

  Fly   105 LYINYLVNVLD----------------GDLDPKGGFRAELKPVSRKICS--EKKHCLKSEIQNVP 151
            .||::|...|.                .:|.| .||...:.|..| :|:  |:.|...:....:|
 Frog   145 SYISHLSAQLGLTEEILTQRRLAETQRTNLCP-SGFSCCMDPTHR-LCTTPEEDHFNPAATPTMP 207

  Fly   152 LS 153
            .|
 Frog   208 FS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 19/52 (37%)
mespbNP_001016653.1 HLH 97..150 CDD:278439 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.