DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Atoh7

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_058560.1 Gene:Atoh7 / 53404 MGIID:1355553 Length:149 Species:Mus musculus


Alignment Length:57 Identity:26/57 - (45%)
Similarity:36/57 - (63%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVL 114
            ::|..||.:||||.|.:|.||..||..:|....|.||||.:||::|:.||..|..:|
Mouse    41 RRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIIALTRIL 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 25/54 (46%)
Atoh7NP_058560.1 bHLH_TS_ATOH7 35..102 CDD:381557 26/57 (46%)

Return to query results.
Submit another query.