DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Bhlhe23

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001102681.1 Gene:Bhlhe23 / 499952 RGDID:1559760 Length:223 Species:Rattus norvegicus


Alignment Length:50 Identity:24/50 - (48%)
Similarity:30/50 - (60%) Gaps:2/50 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RNTANKKERRRTQSINNAFSYLREKIP--NVPTDTKLSKIKTLKLAILYI 107
            |.:.|.:||||...:|:|...||..||  :.|:..|||||.||.||..||
  Rat   100 RLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSKIATLLLAKNYI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 23/49 (47%)
Bhlhe23NP_001102681.1 bHLH_TS_bHLHe22_bHLHb5 99..168 CDD:381524 23/49 (47%)

Return to query results.
Submit another query.