DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and NHLH2

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_005590.1 Gene:NHLH2 / 4808 HGNCID:7818 Length:135 Species:Homo sapiens


Alignment Length:58 Identity:29/58 - (50%)
Similarity:41/58 - (70%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLD 115
            |.|:....:||.|.::.|.||:.||:.:|.:|.|.|||||:.|:|||.||:||.:|||
Human    77 KYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLD 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 25/54 (46%)
NHLH2NP_005590.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..80 1/2 (50%)
bHLH_TS_HEN2 63..135 CDD:381545 29/58 (50%)

Return to query results.
Submit another query.