DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and NEUROD2

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_006151.3 Gene:NEUROD2 / 4761 HGNCID:7763 Length:382 Species:Homo sapiens


Alignment Length:109 Identity:34/109 - (31%)
Similarity:50/109 - (45%) Gaps:15/109 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLDGDLDPKGG 123
            :|..||.:||.|...:|.|...||:.:|......|||||:||:||..||..|..:|      :.|
Human   122 RRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEIL------RSG 180

  Fly   124 FRAELKPVSRKICSEKKH--------CLKSEIQNVPLSTKGRTG 159
            .|.:|....:.:|.....        ||:...:|. |:.:|..|
Human   181 KRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNF-LTEQGADG 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 23/54 (43%)
NEUROD2NP_006151.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..129 3/6 (50%)
bHLH_TS_NeuroD2 88..180 CDD:381563 24/63 (38%)
Nuclear localization signal. /evidence=ECO:0000255 107..113
Neuro_bHLH 180..310 CDD:463621 10/45 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.