DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and ATOH1

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_005163.1 Gene:ATOH1 / 474 HGNCID:797 Length:354 Species:Homo sapiens


Alignment Length:88 Identity:35/88 - (39%)
Similarity:49/88 - (55%) Gaps:6/88 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLDGDLDPKG 122
            ::|..||.:||||...:|:||..||..||:...|.||||.:||::|.:|||.|..:|.   .|.|
Human   159 QRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQ---TPSG 220

  Fly   123 GFRAELKPVSRKICSEKKHCLKS 145
            |.:....|.|   |....|.|::
Human   221 GEQPPPPPAS---CKSDHHHLRT 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 26/54 (48%)
ATOH1NP_005163.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..122
bHLH_TS_ATOH1 155..218 CDD:381556 27/61 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..277 8/31 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..354
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.