DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and ASCL2

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_005161.1 Gene:ASCL2 / 430 HGNCID:739 Length:193 Species:Homo sapiens


Alignment Length:68 Identity:24/68 - (35%)
Similarity:36/68 - (52%) Gaps:10/68 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLV----------NVLDGDL 118
            |::||.|.:.:|..|..||:.:|:.....||||::||:.|:.||..|.          |.|.|.|
Human    56 NERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL 120

  Fly   119 DPK 121
            .|:
Human   121 RPQ 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 20/59 (34%)
ASCL2NP_005161.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..56 24/68 (35%)
bHLH_TS_ASCL2_Mash2 49..112 CDD:381586 19/55 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..177 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.