DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and twi

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster


Alignment Length:146 Identity:46/146 - (31%)
Similarity:69/146 - (47%) Gaps:43/146 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SNTRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLDG 116
            ||.|::     ||.:||:||||:|:||..|::.||.:|:| |||||:|||||..||::|..:|..
  Fly   361 SNQRVM-----ANVRERQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSS 419

  Fly   117 D-------LDPKG-----------------GFRAELKPVSRKICSEKKHCLKSEIQNVPLSTKGR 157
            .       |:.:|                 |..|:||            ||: :....|:....:
  Fly   420 SDISLLKALEAQGSPSAYGSASSLLSAAANGAEADLK------------CLR-KANGAPIIPPEK 471

  Fly   158 TGWPQDVWASELIPEH 173
            ..:...||..|...:|
  Fly   472 LSYLFGVWRMEGDAQH 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 28/50 (56%)
twiNP_001033967.1 HLH 363..413 CDD:278439 29/55 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.