powered by:
Protein Alignment Hand and Ferd3l
DIOPT Version :9
Sequence 1: | NP_609370.2 |
Gene: | Hand / 34379 |
FlyBaseID: | FBgn0032209 |
Length: | 174 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102450.1 |
Gene: | Ferd3l / 366598 |
RGDID: | 1311812 |
Length: | 166 |
Species: | Rattus norvegicus |
Alignment Length: | 56 |
Identity: | 24/56 - (42%) |
Similarity: | 40/56 - (71%) |
Gaps: | 0/56 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 KRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVL 114
:|..||.:||:|..::|.||..||.|:|....:.:||:|:||:|||:||:::..:|
Rat 102 QRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELL 157
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Hand | NP_609370.2 |
HLH |
59..110 |
CDD:278439 |
23/50 (46%) |
Ferd3l | NP_001102450.1 |
HLH |
102..154 |
CDD:278439 |
23/51 (45%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166343505 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.740 |
|
Return to query results.
Submit another query.