DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Ascl5

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_017454536.1 Gene:Ascl5 / 363991 RGDID:1561854 Length:188 Species:Rattus norvegicus


Alignment Length:102 Identity:31/102 - (30%)
Similarity:49/102 - (48%) Gaps:21/102 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HSESQVQQQIYNTSHLG---YVPTSNT----------RIVKKRNTANKKERRRTQSINNAFSYLR 82
            |||..     |..::.|   |||....          ..::||   |::||:|.:.:|..::.||
  Rat    48 HSEPS-----YYDAYTGVFPYVPFPGAFGVYDYPFEPAFIQKR---NERERQRVKCVNEGYARLR 104

  Fly    83 EKIPNVPTDTKLSKIKTLKLAILYINYLVNVLDGDLD 119
            ..:|....:.:|||::||:.||.||.||..:|....|
  Rat   105 GHLPGALAEKRLSKVETLRAAIRYIKYLQELLSAAPD 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 19/50 (38%)
Ascl5XP_017454536.1 HLH 86..136 CDD:197674 19/49 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.