DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and hlh-31

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001023193.2 Gene:hlh-31 / 3565632 WormBaseID:WBGene00009540 Length:164 Species:Caenorhabditis elegans


Alignment Length:87 Identity:25/87 - (28%)
Similarity:36/87 - (41%) Gaps:12/87 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KKRNTANKKERRRTQSINNAFSYLREKIPNVPTDT--KLSKIKTLKL----------AILYINYL 110
            :|..::...:|.|...:|.|...||..||.....:  |||||.||.|          ||..::.|
 Worm    74 RKMKSSKLLKRCRMHDLNEALDDLRAVIPYAHGGSVRKLSKIATLLLAKNHIIMKAKAIEELSVL 138

  Fly   111 VNVLDGDLDPKGGFRAELKPVS 132
            |:.|....:........:||.|
 Worm   139 VSQLKQKSENSKNLNKSVKPSS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 19/62 (31%)
hlh-31NP_001023193.2 bHLH_SF 78..137 CDD:381792 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I4152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.