DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and CG33557

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:118 Identity:38/118 - (32%)
Similarity:63/118 - (53%) Gaps:10/118 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ESQVQQQIYNTSHLGYVPTSNTRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKI 97
            :||:.|:   .:..|.....|.|....|...|.:||.||.::|:|:..||..||..|.:.|||||
  Fly    39 DSQIGQE---ANPGGQENQGNHRRRPPRQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKI 100

  Fly    98 KTLKLAILYINYLVNVLD--GDLDPKGGFRAELKPVSRK--ICSEKKHCLKSE 146
            :.::||..||.:|.:.|:  .:..|....:.|.:.::|:  ||:   .|||::
  Fly   101 EIIRLASSYITHLSSTLETGTECQPCLLHKYESEGITRRISICT---FCLKTK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 22/50 (44%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452827
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I4152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.