DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and bhlha9

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001189344.1 Gene:bhlha9 / 323481 ZFINID:ZDB-GENE-030131-2201 Length:260 Species:Danio rerio


Alignment Length:223 Identity:52/223 - (23%)
Similarity:82/223 - (36%) Gaps:66/223 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALTCEYSTMYYNSIYNTSNMFDMKHSESQVQQ-QIYNTSHLGYVPTSNTRIVKKRN--------- 61
            |..|.:|.....|.  |.:.|..:..:..:|: ::.::..||.:.....|::|||:         
Zfish     4 ASVCRFSMASRGSF--TGSEFSEEEPDGSLQESELDSSDGLGGLNEPEERLIKKRSRPVRSKARR 66

  Fly    62 -TANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLD---------- 115
             .||.:||:|....|.||:.||..:.:..:..:||||.||:.||..|:.|...|.          
Zfish    67 VAANVRERKRILDYNQAFNALRVALHHDLSGKRLSKIATLQRAINRISALSVFLTNNPPVGVAKP 131

  Fly   116 -GDLD-PKGGFRAELKPVSRKI-----------------------------CSEKKH--CLKSEI 147
             |.|: ..||..||.:|..:..                             |....|  |...:.
Zfish   132 CGHLECQPGGLWAEAEPSMQNFLTWHQPLNQHLQTSIHRLSSEQHVFTGPACPPSPHYPCFSPDN 196

  Fly   148 QNVPLST------KGRTG----WPQDVW 165
            |..|.::      .||.|    :.|.||
Zfish   197 QLYPAASVPSPPRYGRIGDVGAYQQGVW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 21/60 (35%)
bhlha9NP_001189344.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..49 5/33 (15%)
HLH 65..116 CDD:278439 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583789
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.