DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Bhlha9

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_796156.3 Gene:Bhlha9 / 320522 MGIID:2444198 Length:231 Species:Mus musculus


Alignment Length:68 Identity:26/68 - (38%)
Similarity:35/68 - (51%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLDGDL 118
            ||...:|..||.:||:|....|.||:.||..:.:.....:||||.||:.||..|..|..||....
Mouse    57 TRSKARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKIATLRRAIHRITALSLVLRASP 121

  Fly   119 DPK 121
            .|:
Mouse   122 APR 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 20/50 (40%)
Bhlha9NP_796156.3 HLH 62..113 CDD:278439 20/50 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.