DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and ascl1b

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_571306.1 Gene:ascl1b / 30478 ZFINID:ZDB-GENE-980526-174 Length:195 Species:Danio rerio


Alignment Length:71 Identity:27/71 - (38%)
Similarity:42/71 - (59%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LGY-VPTSNTRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINY 109
            ||| :|......|.:|   |::||.|.:.:|..|..||:.:||...:.|:||::||:.|:.||..
Zfish    56 LGYTIPQQQPMAVARR---NERERNRVKQVNMGFQTLRQHVPNGAANKKMSKVETLRSAVEYIRA 117

  Fly   110 LVNVLD 115
            |..:||
Zfish   118 LQQLLD 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 20/54 (37%)
ascl1bNP_571306.1 bHLH_SF 63..133 CDD:469605 23/64 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..164
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.