DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and twist2

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001005956.1 Gene:twist2 / 30395 ZFINID:ZDB-GENE-980526-235 Length:163 Species:Danio rerio


Alignment Length:96 Identity:42/96 - (43%)
Similarity:57/96 - (59%) Gaps:5/96 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KHSESQVQQQIYNTSHLGYVPTSN---TRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTD 91
            |.||........|..:....|:|.   ..:..:|..||.:||:||||:|.||:.||:.||.:|:|
Zfish    38 KSSEDSSSPSSVNKRNKKPSPSSTQSFEELQNQRVLANVRERQRTQSLNEAFASLRKIIPTLPSD 102

  Fly    92 TKLSKIKTLKLAILYINYLVNVLDGD-LDPK 121
             |||||:|||||..||::|..||..| :|.|
Zfish   103 -KLSKIQTLKLASRYIDFLCQVLQSDEMDNK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 30/50 (60%)
twist2NP_001005956.1 HLH 70..120 CDD:278439 30/50 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583752
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.