powered by:
Protein Alignment Hand and twist1a
DIOPT Version :9
Sequence 1: | NP_609370.2 |
Gene: | Hand / 34379 |
FlyBaseID: | FBgn0032209 |
Length: | 174 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571059.1 |
Gene: | twist1a / 30175 |
ZFINID: | ZDB-GENE-000210-6 |
Length: | 171 |
Species: | Danio rerio |
Alignment Length: | 73 |
Identity: | 39/73 - (53%) |
Similarity: | 51/73 - (69%) |
Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 PTSNTRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVL 114
|.|...:..:|..||.:||:||||:|.||:.||:.||.:|:| |||||:|||||..||::|..||
Zfish 69 PQSLEDLQTQRVMANVRERQRTQSLNEAFASLRKIIPTLPSD-KLSKIQTLKLAARYIDFLCQVL 132
Fly 115 DGD-LDPK 121
..| ||.|
Zfish 133 QSDELDSK 140
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Hand | NP_609370.2 |
HLH |
59..110 |
CDD:278439 |
30/50 (60%) |
twist1a | NP_571059.1 |
HLH |
78..128 |
CDD:278439 |
30/50 (60%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170583775 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5507 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.870 |
|
Return to query results.
Submit another query.