DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Tcf15

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001162051.1 Gene:Tcf15 / 296272 RGDID:1308464 Length:195 Species:Rattus norvegicus


Alignment Length:143 Identity:53/143 - (37%)
Similarity:69/143 - (48%) Gaps:31/143 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SESQVQQQIY------NTSHLGYVPTSNTR---------IVKKRNTANKKERRRTQSINNAFSYL 81
            |||....|.:      ..:..|..|.|..|         :|::|..||.:||.||||:|.||:.|
  Rat    29 SESDASDQSFGCCEGLEAARRGPGPGSGRRASGGAGPVVVVRQRQAANARERDRTQSVNTAFTAL 93

  Fly    82 REKIPNVPTDTKLSKIKTLKLAILYINYLVNVL---DGDLDPKGGFRA-----ELKPVS-----R 133
            |..||..|.|.|||||:||:||..||.:|.|||   |...|.:..|||     ...|.:     |
  Rat    94 RTLIPTEPVDRKLSKIETLRLASSYIAHLANVLLLGDAADDGQPCFRAAGGGKSAVPAADGRQPR 158

  Fly   134 KICSEKKHCLKSE 146
            .||:   .||.::
  Rat   159 SICT---FCLSNQ 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 29/50 (58%)
Tcf15NP_001162051.1 bHLH_TS_TCF15_paraxis 64..129 CDD:381476 34/64 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343514
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.