DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Neurod1

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_062091.1 Gene:Neurod1 / 29458 RGDID:3165 Length:357 Species:Rattus norvegicus


Alignment Length:66 Identity:26/66 - (39%)
Similarity:34/66 - (51%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLDGDLD 119
            |...:|..||.:||.|...:|.|...||:.:|......|||||:||:||..||..|..:|.....
  Rat    98 RFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKS 162

  Fly   120 P 120
            |
  Rat   163 P 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 23/54 (43%)
Neurod1NP_062091.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..94
bHLH_TS_NeuroD1 75..160 CDD:381562 25/61 (41%)
Nuclear localization signal. /evidence=ECO:0000255 87..93
Neuro_bHLH 160..284 CDD:463621 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.