DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Neurog1

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_062080.1 Gene:Neurog1 / 29410 RGDID:3167 Length:244 Species:Rattus norvegicus


Alignment Length:75 Identity:33/75 - (44%)
Similarity:42/75 - (56%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVL---DGDLDP 120
            :|..||.:||.|..::|.|...||..:|:.|.||||:||:||:.|..||..|...|   |..| |
  Rat    94 RRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNYIWALAETLRLADQGL-P 157

  Fly   121 KGGFRAELKP 130
            .||.|..|.|
  Rat   158 GGGARERLLP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 24/54 (44%)
Neurog1NP_062080.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..84
bHLH_TS_NGN1_NeuroD3 83..154 CDD:381559 25/59 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.