DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Fer1

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:196 Identity:61/196 - (31%)
Similarity:88/196 - (44%) Gaps:43/196 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NSIYNTSNMF--DMKHSESQVQQQIYNT--------SHLGYVPTSN-----------TRIVKKRN 61
            |:..::|:.|  |...|||..:...|::        :...:.|.|.           :::.::|.
  Fly    25 NASTSSSDYFFGDEHSSESDDEDDAYSSGFNSDQENTEKTFCPFSRRSHKPRRLKCASQMAQQRQ 89

  Fly    62 TANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLDGDLDPKGGFRA 126
            .||.:||||.||||.||..||..||.:|.:.:|||:.||||||.||.:|..::..|   |.|...
  Fly    90 AANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKD---KNGNEP 151

  Fly   127 ELKPVSRKICSE--KKHCLKSEIQNVPLS----TKG----------RTGWPQDVWA--SELIPEH 173
            .|. :.|....|  ||..||.....|..|    .||          ||..|:|...  |:.:|.:
  Fly   152 GLS-LQRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPRGPHSQPLPLY 215

  Fly   174 N 174
            |
  Fly   216 N 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 29/50 (58%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452822
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.