DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Ascl5

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001257538.1 Gene:Ascl5 / 226439 MGIID:2685043 Length:188 Species:Mus musculus


Alignment Length:102 Identity:32/102 - (31%)
Similarity:50/102 - (49%) Gaps:21/102 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HSESQVQQQIYNTSHLG---YVPTSNT----------RIVKKRNTANKKERRRTQSINNAFSYLR 82
            |||..     |..::.|   |||....          ..::||   |::||:|.:.:|..::.||
Mouse    48 HSEPP-----YYDAYTGVFPYVPFPGAFGVYDYPFEPAFIQKR---NERERQRVKCVNEGYARLR 104

  Fly    83 EKIPNVPTDTKLSKIKTLKLAILYINYLVNVLDGDLD 119
            ..:|...|:.:|||::||:.||.||.||..:|....|
Mouse   105 GHLPGALTEKRLSKVETLRAAIRYIKYLQELLSATPD 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 22/54 (41%)
Ascl5NP_001257538.1 bHLH_TS_ASCL5 76..136 CDD:381590 22/62 (35%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 80..93 5/15 (33%)
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 94..132 14/37 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..188 1/3 (33%)

Return to query results.
Submit another query.