DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Twist1

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_035788.1 Gene:Twist1 / 22160 MGIID:98872 Length:206 Species:Mus musculus


Alignment Length:76 Identity:40/76 - (52%)
Similarity:52/76 - (68%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GYVPTSNTRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLV 111
            |..|.|...:..:|..||.:||:||||:|.||:.||:.||.:|:| |||||:|||||..||::|.
Mouse   101 GGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSD-KLSKIQTLKLAARYIDFLY 164

  Fly   112 NVLDGD-LDPK 121
            .||..| ||.|
Mouse   165 QVLQSDELDSK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 31/54 (57%)
Twist1NP_035788.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..109 3/7 (43%)
bHLH_TS_TWIST1 102..178 CDD:381418 39/75 (52%)
Sufficient for transactivation activity 165..195 6/11 (55%)

Return to query results.
Submit another query.