DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Tal2

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_033343.1 Gene:Tal2 / 21350 MGIID:99540 Length:108 Species:Mus musculus


Alignment Length:51 Identity:31/51 - (60%)
Similarity:39/51 - (76%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVL 114
            |.:||.|.||:||||:.||:.||..|.|.||||.:||:||:.|||:||.||
Mouse     8 NTRERWRQQSVNNAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVL 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 29/49 (59%)
Tal2NP_033343.1 bHLH_SF 2..62 CDD:469605 31/51 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..108
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.