DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Ptf1a

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_061279.2 Gene:Ptf1a / 19213 MGIID:1328312 Length:324 Species:Mus musculus


Alignment Length:71 Identity:34/71 - (47%)
Similarity:47/71 - (66%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SNTRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLDG 116
            |...:.:.|..||.:||||.||||:||..||..||.:|.:.:|||:.||:|||.|||:|..::..
Mouse   154 SEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQA 218

  Fly   117 DLDPKG 122
            ||..:|
Mouse   219 DLPLRG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 29/50 (58%)
Ptf1aNP_061279.2 HLH 162..217 CDD:238036 30/54 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.