powered by:
Protein Alignment Hand and hlh-13
DIOPT Version :9
Sequence 1: | NP_609370.2 |
Gene: | Hand / 34379 |
FlyBaseID: | FBgn0032209 |
Length: | 174 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508725.1 |
Gene: | hlh-13 / 185980 |
WormBaseID: | WBGene00001957 |
Length: | 147 |
Species: | Caenorhabditis elegans |
Alignment Length: | 57 |
Identity: | 31/57 - (54%) |
Similarity: | 39/57 - (68%) |
Gaps: | 0/57 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 KKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVL 114
::|.||:.:||:|..|||.||..||..||..|.:.:||||.||.|||.|||.|.:||
Worm 41 EERQTASIRERKRMCSINVAFIELRNYIPTFPYEKRLSKIDTLNLAIAYINMLDDVL 97
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Hand | NP_609370.2 |
HLH |
59..110 |
CDD:278439 |
28/50 (56%) |
hlh-13 | NP_508725.1 |
HLH |
43..93 |
CDD:278439 |
28/49 (57%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.