DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and hlh-17

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_502928.3 Gene:hlh-17 / 185460 WormBaseID:WBGene00001961 Length:101 Species:Caenorhabditis elegans


Alignment Length:83 Identity:27/83 - (32%)
Similarity:35/83 - (42%) Gaps:12/83 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RNTANKKERRRTQSINNAFSYLREKIPNVPTDT--KLSKIKTLKL----------AILYINYLVN 112
            |.:.|.:||.|...:|.|...||..||.....:  |||||.||.|          ||..::.||:
 Worm    16 RLSINLRERCRMHDLNEALDDLRAVIPYAHGGSVRKLSKIATLLLAKNHIIMQAKAIEELSILVS 80

  Fly   113 VLDGDLDPKGGFRAELKP 130
            .|....:........|||
 Worm    81 QLKRKSENLENLNKSLKP 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 21/61 (34%)
hlh-17NP_502928.3 bHLH_TS_bHLHe22_like 16..76 CDD:381474 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I4152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.