powered by:
Protein Alignment Hand and hnd-1
DIOPT Version :9
Sequence 1: | NP_609370.2 |
Gene: | Hand / 34379 |
FlyBaseID: | FBgn0032209 |
Length: | 174 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509952.1 |
Gene: | hnd-1 / 183457 |
WormBaseID: | WBGene00001981 |
Length: | 226 |
Species: | Caenorhabditis elegans |
Alignment Length: | 61 |
Identity: | 25/61 - (40%) |
Similarity: | 42/61 - (68%) |
Gaps: | 2/61 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 KRNTANKKERRRTQSINNAFSYLREKIPNVPTDTK--LSKIKTLKLAILYINYLVNVLDGD 117
::..:.:||.||.|.||:||..|::.||.:.::.: |.|||||:||:.||::|..:|.|:
Worm 24 RKEKSREKEHRRAQCINSAFEILQQHIPYLKSEERKSLPKIKTLRLAMQYIDHLKKLLGGN 84
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S4541 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR23349 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.960 |
|
Return to query results.
Submit another query.