DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and hlh-8

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_509367.1 Gene:hlh-8 / 181069 WormBaseID:WBGene00001953 Length:178 Species:Caenorhabditis elegans


Alignment Length:115 Identity:40/115 - (34%)
Similarity:64/115 - (55%) Gaps:14/115 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLDGDLDPK 121
            |::|..||::||:||:.:|:||:.||:.||::|:| |:|||.||::|..||::|      |...|
 Worm    19 VQQRACANRRERQRTKELNDAFTLLRKLIPSMPSD-KMSKIHTLRIATDYISFL------DEMQK 76

  Fly   122 GGFRAELKPVSRKICSEKKHCLKSEIQNVPLSTKGRTGWPQDVWASELIP 171
            .|    .|.....|..||:   ...:|:.....:|..|:......|:|.|
 Worm    77 NG----CKLYGHSIFDEKR---GYNLQSAFNMWRGNNGYTPIAGPSQLPP 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 25/50 (50%)
hlh-8NP_509367.1 HLH 21..71 CDD:278439 25/50 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.900

Return to query results.
Submit another query.