DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Mesp1

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_032614.2 Gene:Mesp1 / 17292 MGIID:107785 Length:243 Species:Mus musculus


Alignment Length:104 Identity:30/104 - (28%)
Similarity:45/104 - (43%) Gaps:28/104 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KRNTANKKERRRTQSINNAFSYLREKIPN--VPTDTKLSKIKTLKLAILYINYLVNVL------- 114
            :|.:|:::|:.|.:::..|...||..:|.  .||...|:||:||:|||.||.:|..||       
Mouse    77 QRQSASEREKLRMRTLARALHELRRFLPPSVAPTGQNLTKIETLRLAIRYIGHLSAVLGLSEDNL 141

  Fly   115 ----------------DGDLDPKGGFRAELKPVSRKICS 137
                            |.||.........|.|.   :||
Mouse   142 RRQRHAVSPRGCPLCPDSDLAQSQSLGPRLSPA---VCS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 21/56 (38%)
Mesp1NP_032614.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 2/8 (25%)
bHLH_SF 77..141 CDD:469605 23/63 (37%)
CPLCP 153..157 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..228
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.