DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and Hand2

DIOPT Version :9

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_034532.3 Gene:Hand2 / 15111 MGIID:103580 Length:217 Species:Mus musculus


Alignment Length:139 Identity:76/139 - (54%)
Similarity:88/139 - (63%) Gaps:14/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SHLGYVP-------TSNTRIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLK 101
            ||.|.||       ....|.||:|.|||:||||||||||:||:.|||.|||||.||||||||||:
Mouse    78 SHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLR 142

  Fly   102 LAILYINYLVNVLDGDLDPKG---GFRAELKPVSRKICSEKK---HCLKSEIQNVPLSTKGRTGW 160
            ||..||.||:::|..| |..|   .|:||:|....|....||   ..|||.:.:....|||||||
Mouse   143 LATSYIAYLMDLLAKD-DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGW 206

  Fly   161 PQDVWASEL 169
            ||.|||.||
Mouse   207 PQHVWALEL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 HLH 59..110 CDD:278439 38/50 (76%)
Hand2NP_034532.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..116 20/37 (54%)
bHLH_TS_HAND2 100..161 CDD:381477 43/61 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839648
Domainoid 1 1.000 80 1.000 Domainoid score I8569
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4688
Isobase 1 0.950 - 0 Normalized mean entropy S4541
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005250
OrthoInspector 1 1.000 - - otm43282
orthoMCL 1 0.900 - - OOG6_108293
Panther 1 1.100 - - O PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 1 1.000 - - X3772
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.