DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hand and MESP2

DIOPT Version :10

Sequence 1:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001035047.1 Gene:MESP2 / 145873 HGNCID:29659 Length:397 Species:Homo sapiens


Alignment Length:116 Identity:30/116 - (25%)
Similarity:49/116 - (42%) Gaps:32/116 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KRNTANKKERRRTQSINNAFSYLREKIPN--VPTDTKLSKIKTLKLAILYINYLVNVLDGDLDPK 121
            :|.:|:::|:.|.:::..|...||..:|.  .|....|:||:||:|||.||.:|..||.      
Human    82 QRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETLRLAIRYIGHLSAVLG------ 140

  Fly   122 GGFRAELKPVSRKICSEKKHCLKSEIQNVPLSTKGRTGWPQDVWASELIPE 172
                         :..|...|.:.:        :|..|.|   |...|.|:
Human   141 -------------LSEESLQCRRRQ--------RGDAGSP---WGCPLCPD 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 20/56 (36%)
MESP2NP_001035047.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..92 3/9 (33%)
bHLH_TS_Mesp 82..146 CDD:381508 23/82 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..208 6/27 (22%)
13 X 2 AA tandem repeats of G-Q 179..204
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..295
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..376
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.